6 products were found matching "GeneID 338324"!

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....

function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...

function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...

The human calcium-binding protein (hS100A15) was first identified in inflamed hyperplastic psoriatic skin, where the S100A15 gene is transcribed into two mRNA splice variants, hS100A15-S and hS100A15-L. In cultured keratinocytes, IL-1beta and Th1 cytokines significantly induced hS100A15-L compared with hS100A15-S....

Source:, Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at...

May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD, AA Sequence:...